PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Manes.09G097500.2.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Crotonoideae; Manihoteae; Manihot
Family TALE
Protein Properties Length: 507aa    MW: 55674.8 Da    PI: 7.8062
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Manes.09G097500.2.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox29.31.5e-094304671954
                          HHH..SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
             Homeobox  19 Fek..nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                          Fe   ++yp+ +++  LAk++gL+ +qV++WF N R +
  Manes.09G097500.2.p 430 FEHflHPYPTDTDKLMLAKQTGLSRSQVSNWFINARVR 467
                          554459******************************88 PP

2BELL108.83.3e-35298366472
                 BELL   4 elqkkkakLlslleeVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeqi 72 
                          e ++kk++L+s+l+eV++rYk+y++q+q+v+ sFe+vaglg+a+pY++lA k++SrhFr+Lk+ai++q+
  Manes.09G097500.2.p 298 ESRRKKSRLISMLDEVYRRYKHYYQQIQAVVTSFECVAGLGNAAPYANLAVKTMSRHFRSLKNAITDQL 366
                          7899**************************************************************997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005741.9E-53233364IPR006563POX domain
PfamPF075263.0E-39238363IPR006563POX domain
PROSITE profilePS5007112.098408471IPR001356Homeobox domain
CDDcd000862.74E-13411472No hitNo description
SMARTSM003893.4E-10411475IPR001356Homeobox domain
SuperFamilySSF466893.85E-17413478IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.608.2E-28414475IPR009057Homeodomain-like
PfamPF059208.6E-19428467IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010051Biological Processxylem and phloem pattern formation
GO:0010076Biological Processmaintenance of floral meristem identity
GO:0010077Biological Processmaintenance of inflorescence meristem identity
GO:0010089Biological Processxylem development
GO:0010154Biological Processfruit development
GO:0010223Biological Processsecondary shoot formation
GO:0010228Biological Processvegetative to reproductive phase transition of meristem
GO:0045892Biological Processnegative regulation of transcription, DNA-templated
GO:0048457Biological Processfloral whorl morphogenesis
GO:0048645Biological Processorgan formation
GO:0080006Biological Processinternode patterning
GO:0005634Cellular Componentnucleus
GO:0005829Cellular Componentcytosol
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 507 aa     Download sequence    Send to blast
MAEGFEPYHV PQQSRRDKLR VVAQNHPDLQ GCTGLLPLYD PSLLSSDLLA CANPSLSGVS  60
ETCKANGVSV VKEEGVNLMG FVAGIVNAAS SSATTSHHPY LDPQSSLPIN PTSIQDINAN  120
PFFYAAHNLQ NLRDFDQPYN GGSEAVAFKP EPLSLARESN TTGQGLSLSL SSHHTHQGNI  180
PLELNLQRYG SAVYGDKVTA GGGDGYIVPG IVGGSGSTSN DLSRSTVPLG PFTGYASILK  240
GSRFLKPAQQ LLEEFCDMGR GIYSEKITMD ASLMDPPVEC LNACGIVDDP LTCGDGGESR  300
RKKSRLISML DEVYRRYKHY YQQIQAVVTS FECVAGLGNA APYANLAVKT MSRHFRSLKN  360
AITDQLQLTN KGHGQLSLGK EEPTRFGNID RGIYCQRPVQ NSGFIEHQPV WRPQRGLPER  420
AVTVLRAWLF EHFLHPYPTD TDKLMLAKQT GLSRSQVSNW FINARVRLWK PMVEEIHMLE  480
TRQAQKSSQR EEQNANKSSD QGMRKH*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4xrm_A1e-16417475563Homeobox protein Meis2
4xrm_B1e-16417475563Homeobox protein Meis2
4xrs_A1e-16417474158Homeobox protein Meis1
4xrs_B1e-16417474158Homeobox protein Meis1
5bng_A1e-16417475159Homeobox protein Meis2
5bng_B1e-16417475159Homeobox protein Meis2
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010654234.10.0PREDICTED: BEL1-like homeodomain protein 9
SwissprotQ9LZM81e-109BLH9_ARATH; BEL1-like homeodomain protein 9
TrEMBLA5AHA10.0A5AHA1_VITVI; Putative uncharacterized protein
TrEMBLF6HL250.0F6HL25_VITVI; Putative uncharacterized protein
STRINGVIT_08s0007g01290.t010.0(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G02030.11e-108TALE family protein